PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G38320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 573aa    MW: 61758.9 Da    PI: 7.1653
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G38320.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM84.91.6e-262764093128
              NAM   3 pGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknr...atksgyWkatgk 88 
                      pG+rF Ptd+el+ ++Lk+k +  + ++++ + ik++d++k++  +L+      k+ +  wy Fs+r++ +++g r+ r   +t+ gyWk+   
  OGLUM03G38320.1 276 PGVRFTPTDQELIIHFLKPKYNLLDaMPTNIIvIKQLDVCKLNLDELHGdlgLGKSLDGAWYVFSPRSRYKERGVRPARgikTTAVGYWKSNSA 369
                      9*******************8887765554445**************9534322334459*****************996534779******** PP

              NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +v++ +ge++g  ++L++  g++p+g+ t+W m+eyr+
  OGLUM03G38320.1 370 EADVVDDDGEVIGRVNSLTLALGHQPRGKATHWRMKEYRI 409
                      **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.208274450IPR003441NAC domain
SuperFamilySSF1019411.7E-30275449IPR003441NAC domain
PfamPF023659.5E-15276409IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MAAINPVAGE VAAATAKAPP PAMATVRAPL PANHYSPYHS ASAAGSYAAN TQSTSSPVSP  60
ASPAMISSSS SSLPPQQQRT WQPQPTTFSQ ANPGHAYQQD HLPAVAGRRF FPPPAMQMQY  120
YHQQPAGVAM VGSGHPMAAP VHSSPLATTS GSNHAVVPDA PPQEPAKRRR RNTAAAATAR  180
RGRGRPRGAT ASSAHSAPPP PQQQQQPTTS APAITAQRND DVNQEDDNQS SKNSAEEAVV  240
VAGSEPPAAT SALAIVPRHG DVGDADRPVS PYSDIPGVRF TPTDQELIIH FLKPKYNLLD  300
AMPTNIIVIK QLDVCKLNLD ELHGDLGLGK SLDGAWYVFS PRSRYKERGV RPARGIKTTA  360
VGYWKSNSAE ADVVDDDGEV IGRVNSLTLA LGHQPRGKAT HWRMKEYRIP HLLRMKVVKL  420
KLNSRGGTYK RTAYSLFPLD EWVLCKLYHS FAYKQKGKCK VHEEGSKSDR GVQDLSIDDD  480
RKTCDIEANK PNGGVDNCNV NICDIEDSKP DGGLQDQSAD DYNAHICNIE ASKPDGALQD  540
LSVDDYGICD IDFAPKYADP SSEEMHERNI GEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-1926845614174NAC domain-containing protein 19
3swm_B6e-1926845614174NAC domain-containing protein 19
3swm_C6e-1926845614174NAC domain-containing protein 19
3swm_D6e-1926845614174NAC domain-containing protein 19
3swp_A6e-1926845614174NAC domain-containing protein 19
3swp_B6e-1926845614174NAC domain-containing protein 19
3swp_C6e-1926845614174NAC domain-containing protein 19
3swp_D6e-1926845614174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1375070.0AC137507.3 Oryza sativa chromosome 3 BAC OSJNBb0033J23 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9ZEV20.0A0A0D9ZEV2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA009585-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131302130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.16e-23NAC domain containing protein 47